Effector profile
PlantPEAD ID: PlantPEAD00125 Uniprot ID: G3C9Q9 Source: Article
Localization: Cytoplasmic(Exp) Pathogen taxonomy ID: 272952 Pathogen type: Oomycota
Species: Hyaloperonospora arabidopsidis Strain: strain Emoy2 Other name: Peronospora arabidopsidis
Gene name: HaRxL75 NCBI Gene ID: HE574757
Entry name: G3C9Q9_HYAAE Protein name: RxLR effector candidate
DOI: 10.1094/MPMI-06-12-0154-R
Gene/Protein information
Gene sequence:
CGAAGTCTACGGACTGAAGAGAAGCGCGGTCAGAGCGACCTGGGAGAGGAAAGGGGGCGCGGGAATCTACCGACTACCGATAGTTTTAGTGCATCCCTAAAACGCTTCATTCGCGCCCTGTTTTGCATGGGATCGAAAAAAGGAATGACACGAACCAAGTCGTCGGGTTCTTCCATCGTGTCGGGTCATGGTAGGTAA
Protein sequence:
RSLRTEEKRGQSDLGEERGRGNLPTTDSFSASLKRFIRALFCMGSKKGMTRTKSSGSSIVSGHGR
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
7105.02 65 11.22 -0.895 53.88
Plant infestation information
Experimental plant: Arabidopsis thaliana (related: thale cress)
Susceptible plant: Arabidopsis thaliana Disease name: Downy mildew of Arabidopsis
Host classification: Eudicots NCBI Species: 3702
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.