Effector profile
PlantPEAD ID: PlantPEAD00135 Uniprot ID: H7CE70 Source: Article
Localization: Apoplastic(Exp) Pathogen taxonomy ID: 5465 Pathogen type: Fungi
Species: Colletotrichum orbiculare Strain: strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422 Other name: Cucumber anthracnose fungus, Colletotrichum lagenarium
Gene name: CoMC69 NCBI Gene ID: AB669186
Entry name: MC69_COLOR Protein name: Secreted virulence factor MC69
DOI: 10.1371/journal.ppat.1002711
Gene/Protein information
Gene sequence:
ATGAAGTTTACACTCGCTCTCCTGACGACGCTGTGCGCGTCATTAGCCTCCGCTGGCGTTGTCATCACACCTGTACGCCCGAACCAGGTAATACCGGCCAACAGCGGCGATTGCTTCTTTGGTGTTGTGACGCCACAAGGTTGCGCGTAAGTACCGGTCACCACGCATGTGTGATACGCAAAAAGCTAACCATGTCTGTAGTCCTCTGAGAAAGTCATGA
Protein sequence:
MKFTLALLTTLCASLASAGVVITPVRPNQVIPANSGDCFFGVVTPQGCAPLRKS
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
5562.61 54 9.15 0.648 26.32
Plant infestation information
Experimental plant: Cucumis sativus (related: cucumber)
Susceptible plant: Cucumis sativus Disease name: Anthracnose of cucurbits
Host classification: Eudicots NCBI Species: 3659
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.