Effector profile
| PlantPEAD ID: PlantPEAD00618 | Uniprot ID: P0CU98 | Source: Article |
| Localization: Cytoplasmic(Exp) | Pathogen taxonomy ID: 143451 | Pathogen type: Oomycota |
| Species: Plasmopara viticola | Strain: | Other name: Botrytis viticola |
| Gene name: RXLR15 | NCBI Gene ID: NONE | |
| Entry name: RLR15_PLAVT | Protein name: Secreted RxLR effector protein 15 | |
| DOI: 10.3389/fpls.2018.00286 | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MRGHSALMMAVVTLAAVSSGAAEVANTAAVSSDYLIGTILTFAESDRLLRVNDVDDVPVYHYPPEKGKRTTFFEDRMKKKLANPEKIRRLYWKWYSMGYSAREVVQHLDQTDNRELKEIYHNLGVGYAEFVAKMNV
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 15475.7 | 136 | 7.94 | -0.31 | 35.18 |
Plant infestation information
| Experimental plant: Nicotiana benthamiana (no common name found) | |
| Susceptible plant: Vitis vinifera | Disease name: Downy mildew of grapevine |
| Host classification: Eudicots | NCBI Species: 29760 |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR031825
Pfam: PF16810
SMART:
KEGG:
PRINTS: