Effector profile
| PlantPEAD ID: PlantPEAD00629 | Uniprot ID: P0CV14 | Source: Article |
| Localization: Cytoplasmic(Exp) | Pathogen taxonomy ID: 143451 | Pathogen type: Oomycota |
| Species: Plasmopara viticola | Strain: | Other name: Botrytis viticola |
| Gene name: RXLR48 | NCBI Gene ID: NONE | |
| Entry name: RLR48_PLAVT | Protein name: Secreted RxLR effector protein 48 | |
| DOI: 10.3389/fpls.2018.00286 | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MCCVSWNWVLACTFLLIFLSWWNCCNDRISVNSGVPGMAARVAGAHHVVLTEQDELLRLLRVNLAANAEVLTHEIEEEKGGIVARPLSWGIEHTKEYLARYGDEKIDVILSCDCIYEPLYGTSWKGLAQTMELLCLANPKSVVLLAVERRNEDGIDKFLAFVEKETMLLYRRDEVTVGSSKNRLEVYHLHLENILKN
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 22407.9 | 197 | 5.4 | 0.049 | 38.15 |
Plant infestation information
| Experimental plant: Nicotiana benthamiana (no common name found) | |
| Susceptible plant: Vitis vinifera | Disease name: Downy mildew of grapevine |
| Host classification: Eudicots | NCBI Species: 29760 |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR019410,IPR029063
Pfam: PF10294
SMART:
KEGG:
PRINTS: