Effector profile
| PlantPEAD ID: PlantPEAD00652 | Uniprot ID: P0CV52 | Source: Article | 
| Localization: Cytoplasmic(Exp) | Pathogen taxonomy ID: 143451 | Pathogen type: Oomycota | 
| Species: Plasmopara viticola | Strain: | Other name: Botrytis viticola | 
| Gene name: RXLR124 | NCBI Gene ID: NONE | |
| Entry name: RL124_PLAVT | Protein name: Secreted RxLR effector protein 124 | |
| DOI: 10.3389/fpls.2018.00286 | ||
Gene/Protein information
Gene sequence:
NONE
                Protein sequence:
MPVLVSVALVARHSDTLGALQHVEQTISDFIDYSKCWTMAKAVSCRNIRLLRRILVHRGKDDNEGSCMDIERAMEVASASGDMEMVQFLHETYPQHGKTRCLELAASNGHLDVLRWIYKHRNGKDTLTMSAFDFAAGNGHLDVVEWMHANRSRGCSTRAMDCAARNGHLHIVQWLHAHRQEGCTTQAMDWAAQEGHFEVVQWLLLNRQEGCSSIAIDAAASNGHLKLVHWLHEHCNVTCSYFACAMAAERGHHHILEWIGQIEQT
            Loading ...
                
            Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index | 
|---|---|---|---|---|
| 29886.9 | 265 | 6.38 | -0.251 | 43.6 | 
Plant infestation information
| Experimental plant: Nicotiana benthamiana (no common name found) | |
| Susceptible plant: Vitis vinifera | Disease name: Downy mildew of grapevine | 
| Host classification: Eudicots | NCBI Species: 29760 | 
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence | 
|---|
No Record found.
                    External Links
Interpro: IPR002110,IPR036770
        Pfam: PF12796
        SMART: 
        KEGG: 
        PRINTS: