Effector profile
| PlantPEAD ID: PlantPEAD00666 | Uniprot ID: P0CV74 | Source: Article | 
| Localization: Cytoplasmic(Exp) | Pathogen taxonomy ID: 4792 | Pathogen type: Oomycota | 
| Species: Phytophthora parasitica | Strain: | Other name: Brown rot and root rot of citrus agent, buckeye rot agent, pineapple heart rot agent, pistachio foot rot agent, sesame blight agent | 
| Gene name: PSE1 | NCBI Gene ID: NONE | |
| Entry name: PSE1_PHYPR | Protein name: Secreted RxLR effector protein PSE1 | |
| DOI: 10.1111/nph.12270 | ||
Gene/Protein information
Gene sequence:
NONE
                Protein sequence:
MRLSSFIVVGAAVVNLLTSGSVVVAAFPRVSDVSAMAIAPHRMDQGATNGGKRLLRYHSNNNRGGDEDIAEERGIFDFKNLEMLTNLARLNKANNLDSRLDDFFQALIKAKVNPTNIHHTRLDQDDYLELRQLFRTWYTFYHRAS
            Loading ...
                
            Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index | 
|---|---|---|---|---|
| 16424.6 | 145 | 9.09 | -0.326 | 25.45 | 
Plant infestation information
| Experimental plant: Nicotiana benthamiana (no common name found) | |
| Susceptible plant: Solanum lycopersicum, Solanum tuberosum | Disease name: Buckeye rot | 
| Host classification: Eudicots | NCBI Species: 4081, 4113 | 
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence | 
|---|
No Record found.
                    External Links
Interpro: IPR031825
        Pfam: PF16810
        SMART: 
        KEGG: 
        PRINTS: