Effector profile
PlantPEAD ID: PlantPEAD00666 Uniprot ID: P0CV74 Source: Article
Localization: Cytoplasmic(Exp) Pathogen taxonomy ID: 4792 Pathogen type: Oomycota
Species: Phytophthora parasitica Strain: Other name: Brown rot and root rot of citrus agent, buckeye rot agent, pineapple heart rot agent, pistachio foot rot agent, sesame blight agent
Gene name: PSE1 NCBI Gene ID: NONE
Entry name: PSE1_PHYPR Protein name: Secreted RxLR effector protein PSE1
DOI: 10.1111/nph.12270
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MRLSSFIVVGAAVVNLLTSGSVVVAAFPRVSDVSAMAIAPHRMDQGATNGGKRLLRYHSNNNRGGDEDIAEERGIFDFKNLEMLTNLARLNKANNLDSRLDDFFQALIKAKVNPTNIHHTRLDQDDYLELRQLFRTWYTFYHRAS
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
16424.6 145 9.09 -0.326 25.45
Plant infestation information
Experimental plant: Nicotiana benthamiana (no common name found)
Susceptible plant: Solanum lycopersicum, Solanum tuberosum Disease name: Buckeye rot
Host classification: Eudicots NCBI Species: 4081, 4113
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.