Effector profile
| PlantPEAD ID: PlantPEAD00701 | Uniprot ID: P0CV25 | Source: Article | 
| Localization: Cytoplasmic(Exp) | Pathogen taxonomy ID: 143451 | Pathogen type: Oomycota | 
| Species: Plasmopara viticola | Strain: | Other name: Botrytis viticola | 
| Gene name: RXLR78 | NCBI Gene ID: NONE | |
| Entry name: RLR78_PLAVT | Protein name: Secreted RxLR effector protein 78 | |
| DOI: 10.3389/fpls.2018.00286 | ||
Gene/Protein information
Gene sequence:
NONE
                Protein sequence:
MMKTVMMMLAILATAKAEPQLAAASSRVILLLDFKKAYDSVAREFLFLVLLRFEFSPMFVRMLRKLHDGTTARFLVNGELSEPQEVVSGIRQGCSLAPLLFILAAEVLALSIQ
            Loading ...
                
            Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index | 
|---|---|---|---|---|
| 12561.1 | 113 | 8.98 | 0.659 | 35.49 | 
Plant infestation information
| Experimental plant: Nicotiana benthamiana (no common name found) | |
| Susceptible plant: Vitis vinifera | Disease name: Downy mildew of grapevine | 
| Host classification: Eudicots | NCBI Species: 29760 | 
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence | 
|---|
No Record found.
                    External Links
Interpro: IPR000477
        Pfam: PF00078
        SMART: 
        KEGG: 
        PRINTS: