Effector profile
PlantPEAD ID: PlantPEAD00712 Uniprot ID: P0CV65 Source: Article
Localization: Cytoplasmic(Exp) Pathogen taxonomy ID: 143451 Pathogen type: Oomycota
Species: Plasmopara viticola Strain: Other name: Botrytis viticola
Gene name: RXLR151 NCBI Gene ID: NONE
Entry name: RL151_PLAVT Protein name: Secreted RxLR effector protein 151
DOI: 10.3389/fpls.2018.00286
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MRNRAVLFGLFFIGYSSCVFHATPTRASLVENPDVESTHVEQWDSNGKRLLQVDGPKRILAEERGMSEGILPAAEAVEKTKVSEKAVPRASLGSKLNPMTWPKRILHKLKLWYARFLHWLLRKATVDEKTIDRSMMNGLTPSNLKRVKNDILHYSSSVPHDKIEIETDYDSYVEHFFGQFKGLDKDPPVFEMDKWNNLEKEMTKAEGYLKRRALNTVSRNIDKGLSNEQLISLDVSPFVYMRLLEKRGVFKDVENNKDKIDQLKDYIKAYKEHLMVEQ
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
32231.1 278 9.02 -0.579 43.5
Plant infestation information
Experimental plant: Nicotiana benthamiana (no common name found)
Susceptible plant: Vitis vinifera Disease name: Downy mildew of grapevine
Host classification: Eudicots NCBI Species: 29760
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.