Effector profile
PlantPEAD ID: PlantPEAD00747 Uniprot ID: P0CU87 Source: Article
Localization: Cytoplasmic(Exp) Pathogen taxonomy ID: 4779 Pathogen type: Oomycota
Species: Bremia lactucae Strain: Other name:
Gene name: BLR08 NCBI Gene ID: NONE
Entry name: BRL08_BRELC Protein name: Secreted RxLR effector protein BLR08
DOI: 10.1371/journal.pone.0226540; 10.1111/tpj.14383
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MAEFRFRPTTLLFLIVALIFRCAIDPVSANADLTPSPRLLRDLVQFDATQTVAHTLSNSPSASSSSAEATVHPAASAEASAISNHTTDNAASAESSAESKHELPSIMSFIGPAAAGVLAIVLIGAVIAFKYRSSK
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
14056 135 6.03 0.311 39.08
Plant infestation information
Experimental plant: Lactuca sativa (related: Lettuce)
Susceptible plant: Lactuca sativa Disease name: Downy mildew of lettuce
Host classification: Eudicots NCBI Species: 4236
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.