Effector profile
PlantPEAD ID: PlantPEAD00957 | Uniprot ID: G1K3S4 | Source: Article |
Localization: Cytoplasmic(Pre) | Pathogen taxonomy ID: 4784 | Pathogen type: Oomycota |
Species: Phytophthora capsici | Strain: | Other name: |
Gene name: Avr3a11 | NCBI Gene ID: NONE | |
Entry name: G1K3S4_PHYCP | Protein name: RxLR effector protein | |
DOI: 10.1074/jbc.M111.262303 |
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
GPTEKAAVKKMAKAIMADPSKADDVYQKWADKGYTLTQLSDFLKSKTRGKYDRVYNGYMTYRDYV
Loading ...
Main properties of effector
Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
---|---|---|---|---|
7478.54 | 65 | 9.49 | -0.891 | 6.71 |
Plant infestation information
Experimental plant: | |
Susceptible plant: Capsicum annuum | Disease name: Phytophthora blight of pepper |
Host classification: Eudicots | NCBI Species: 4072 |
Pathogen-plant protein interaction
Uniprot ID | Protein name | Gene name | Species | Protein sequence |
---|
No Record found.
External Links
Interpro: IPR031825
Pfam: PF16810
SMART:
KEGG:
PRINTS: