Effector profile
PlantPEAD ID: PlantPEAD00957 Uniprot ID: G1K3S4 Source: Article
Localization: Cytoplasmic(Pre) Pathogen taxonomy ID: 4784 Pathogen type: Oomycota
Species: Phytophthora capsici Strain: Other name:
Gene name: Avr3a11 NCBI Gene ID: NONE
Entry name: G1K3S4_PHYCP Protein name: RxLR effector protein
DOI: 10.1074/jbc.M111.262303
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
GPTEKAAVKKMAKAIMADPSKADDVYQKWADKGYTLTQLSDFLKSKTRGKYDRVYNGYMTYRDYV
Protein structure:
PDB(X-ray)(3ZR8)
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
7478.54 65 9.49 -0.891 6.71
Plant infestation information
Experimental plant:
Susceptible plant: Capsicum annuum Disease name: Phytophthora blight of pepper
Host classification: Eudicots NCBI Species: 4072
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.