Effector profile
PlantPEAD ID: PlantPEAD00990 Uniprot ID: N4VVN8 Source: Article
Localization: Cytoplasmic(Pre) Pathogen taxonomy ID: 5465 Pathogen type: Fungi
Species: Colletotrichum orbiculare Strain: strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422 Other name: Cucumber anthracnose fungus, Colletotrichum lagenarium
Gene name: SIB1 NCBI Gene ID: AMCV02000021
Entry name: N4VVN8_COLOR Protein name: Uncharacterized protein
DOI: 10.1016/j.jbc. 2021.101370
Gene/Protein information
Gene sequence:
ATGCAGCTCACCAAGCTCTTTGTTGCGACCATCTTCGGCTTCGCTACTTTTGCCATGGCGCAAGAGGGCAAATGCACTGCCAAGGGCGAGTGCCAGGAGAACACTAGCGGCGTCAAACTCTTCTGCACGTCTGGAAGCTGTGCCAAGAAGGAGGGTCAGGCATGCACGAGAAACGGTCCAGGATCGTCGAATTCTGCAAGCTGCCCTAAGTAA
Protein sequence:
MQLTKLFVATIFGFATFAMAQEGKCTAKGECQENTSGVKLFCTSGSCAKKEGQACTRNGPGSSNSASCPK
Protein structure:
PDB(X-ray)(7EAU)
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
7247.28 70 8.86 -0.224 50.14
Plant infestation information
Experimental plant: Nicotiana benthamiana (no common name found)
Susceptible plant: Cucumis sativus Disease name: Anthracnose of cucurbits
Host classification: Eudicots NCBI Species: 3659
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.