Effector profile
PlantPEAD ID: PlantPEAD01081 Uniprot ID: H6S3X4 Source: Article
Localization: Cytoplasmic(Exp) Pathogen taxonomy ID: 143451 Pathogen type: Oomycota
Species: Plasmopara viticola Strain: SC Other name: Botrytis viticola
Gene name: RXLR31154 NCBI Gene ID: NONE
Entry name: RLR18_PLAVT Protein name: Secreted RxLR effector protein 18
DOI: 10.1111/tpj.15252
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MRGSTAMLLAAIALFSSQSFATAIGKSRTLRSFEELEERQLASGSGSNNGLDDVKRSALVELLGEKVVAGGPTSILKAMMKLSDEELQNFIDKNIGSDSDSASGGN
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
11097.5 106 4.88 -0.162 48.32
Plant infestation information
Experimental plant: Vitis vinifera (related: grapevine)
Susceptible plant: Vitis vinifera Disease name: Downy mildew of grapevine
Host classification: Eudicots NCBI Species: 29760
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.