Effector profile
PlantPEAD ID: PlantPEAD01122 Uniprot ID: NONE Source: Article
Localization: Cytoplasmic(Exp) Pathogen taxonomy ID: 4792 Pathogen type: Oomycota
Species: Phytophthora parasitica Strain: Other name: Brown rot and root rot of citrus agent, buckeye rot agent, pineapple heart rot agent, pistachio foot rot agent, sesame blight agent
Gene name: AVH195 NCBI Gene ID: NONE
Entry name: Protein name:
DOI: 10.1094/MPMI-08-21-0201-R
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MRLPYVLLLAVCIIIASCNALSAYEQEAVVAQNAQRWSSTHSVAAAETGDTFGKRLLRFDSIPTVDAEERALPGMTKLTETLKKWISALRSKLSNKKLWWNYQKLGKQKLSDLDITGMWLKNGKSYDDIFDRWIRLDKSPRQAAKNLLNHGTTTNDLYKVLRKRNMNLETIRPIWREVGLTEYQLRAARHAASAL
Protein structure:
NONE
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
22305.8 195 9.85 -0.389 38.06
Plant infestation information
Experimental plant:
Susceptible plant: Solanum lycopersicum, Solanum tuberosum Disease name: Buckeye rot
Host classification: Eudicots NCBI Species: 4081, 4113
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.