Effector profile
PlantPEAD ID: PlantPEAD01191 Uniprot ID: NONE Source: Article
Localization: Cytoplasmic(Exp) Pathogen taxonomy ID: 27350 Pathogen type: Fungi
Species: Puccinia striiformis Strain: f. sp. tritici Other name:
Gene name: PstCTE1 NCBI Gene ID: NONE
Entry name: Protein name:
DOI: 10.1007/s10658-020-02033-6
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MQLYISIGLVLLIATTVKTLTKTGAFLEPLFTKVTKREDKFCTNGGAHYCFKKIAKEGGLFVHIAIPTSPNEKTDDSLCNKLRSGFKATKSCCEYKKFDQIPQEKDIDRDIFIVTNKGFETACSQDVGRSTS
Protein structure:
NONE
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
14695 132 8.89 -0.261 39.52
Plant infestation information
Experimental plant: Triticum aestivum (related: bread wheat)
Susceptible plant: Triticum aestivum Disease name: Stripe rust of wheat
Host classification: Monocots NCBI Species: 4565
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.