Effector profile
PlantPEAD ID: PlantPEAD01197 Uniprot ID: NONE Source: Article
Localization: Apoplastic(Exp) Pathogen taxonomy ID: 27350 Pathogen type: Fungi
Species: Puccinia striiformis Strain: f. sp. tritici Other name:
Gene name: PstSCR1 NCBI Gene ID: NONE
Entry name: Protein name:
DOI: 10.1038/s41598-017-01100-z
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
FKCPGLHGTPSQTHGYCTRSITDEERKAKKIGKEFTMWKEEIKTVDGKFSCDKVDLNGSVATDSFCCDVAGRIGEVEKSKQAMWTNNCSKAS
Protein structure:
NONE
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
10183.5 92 8.26 -0.713 25.5
Plant infestation information
Experimental plant:
Susceptible plant: Triticum aestivum Disease name: Stripe rust of wheat
Host classification: Monocots NCBI Species: 4565
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.