Effector profile
PlantPEAD ID: PlantPEAD01199 Uniprot ID: NONE Source: Article
Localization: Cytoplasmic(Exp) Pathogen taxonomy ID: 4781 Pathogen type: Oomycota
Species: Plasmopara halstedii Strain: Other name:
Gene name: PhRXLR-C01 NCBI Gene ID: NONE
Entry name: Protein name:
DOI: 10.1111/tpj.14157
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MRVPAFSSILHLFAAMGLLVDVLGALSHTTQTLHNNQRNATDRQLRAQDSRAKKKVIGDEERVYKFPFDLNKVPPLSPTRLIDIPPEFQLHPVVRGQQEATTSEVDSSFVDKMETILAETDKQTLKGLLKISALLGTI
Protein structure:
NONE
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
15376.7 138 8.06 -0.224 41.61
Plant infestation information
Experimental plant: Helianthus annuus (related: common sunflower)
Susceptible plant: Helianthus annuus Disease name: Downy mildew of sunflower
Host classification: Eudicots NCBI Species: 4232
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.