Effector profile
PlantPEAD ID: PlantPEAD01216 Uniprot ID: NONE Source: Article
Localization: Cytoplasmic(Exp) Pathogen taxonomy ID: 189291 Pathogen type: Nematoda
Species: Meloidogyne graminicola Strain: Other name: Rice Root-Knot Nematode
Gene name: Mg16820 NCBI Gene ID: NONE
Entry name: Protein name:
DOI: 10.1111/mpp.12719
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MSKFLIVLVIFIFVFIESSNAGRRRGVPQFAPRGDIGDDRRHAQTDHGRDSDSYGNSNGGSYGSANSFGAHGQCDHIPREELDFQRMIGQ
Protein structure:
NONE
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
9971.98 90 6.39 -0.586 51.01
Plant infestation information
Experimental plant: Nicotiana benthamiana (no common name found)
Susceptible plant: Oryza sativa Disease name: Root-knot of rice
Host classification: Monocots NCBI Species: 4530
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.