Effector profile
| PlantPEAD ID: PlantPEAD01267 | Uniprot ID: W2RAR9 | Source: Article |
| Localization: Cytoplasmic(Exp) | Pathogen taxonomy ID: 4792 | Pathogen type: Oomycota |
| Species: Phytophthora parasitica | Strain: INRA-310 | Other name: Brown rot and root rot of citrus agent, buckeye rot agent, pineapple heart rot agent, pistachio foot rot agent, sesame blight agent |
| Gene name: PPTG_01869 | NCBI Gene ID: NONE | |
| Entry name: W2RAR9_PHYPN | Protein name: RxLR effector protein | |
| DOI: 10.3389/fmicb.2022.856106 | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MHLPHVLLLALCIAIASCDAISAFVTEQEAAVVQNAQRLGLSHSVVAARDRGASGKRLLRSDNLPTVTNDVDAEERALPGITKLSELAKKGKSAVSTKLSDKMLWLKYQKLGKQKLSDLDITGMWLKSGKGPDKIFDRWIRLSKSPKQAAQNLLNHGTTTNDLYKVLRKRNMNLETIRPIWRDLGLTENQLRVARHAVSAL
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 22283.9 | 201 | 10 | -0.279 | 33.56 |
Plant infestation information
| Experimental plant: Nicotiana benthamiana (no common name found) | |
| Susceptible plant: Solanum lycopersicum, Solanum tuberosum | Disease name: Buckeye rot |
| Host classification: Eudicots | NCBI Species: 4081, 4113 |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR031825
Pfam: PF16810
SMART:
KEGG:
PRINTS: