Effector profile
| PlantPEAD ID: PlantPEAD03404 | Uniprot ID: A0A0G2FPW7 | Source: Orthologous |
| Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 1214573 | Pathogen type: Fungi |
| Species: Diaporthe ampelina | Strain: DA912 | Other name: |
| Gene name: | NCBI Gene ID: LCUC01000139 | |
| Entry name: A0A0G2FPW7_9PEZI | Protein name: Putative necrosis and ethylene inducing peptide 2 | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MSLRTALFSLAVMAGSAFAAPAKLSTRQIIDHNAVASFPESVPDSAVGKLITKYAPHLRIADGCVPFPAVDSMGNIGDGLKPTGSSAGDCSTSQGQVYARAATFRDRFAIMYSWYMPKTEPSAHLGHRHNWNNAIVWLSDDGDEATLLGTSISQKSSYDQSTTPALDGAAPLLYYKSNWPSVHKLYYDSLEGQQESIRVVDVPLVAWDSLPTASQEALATADFGDDEVVPFIDTHFNDKLGAAYGA
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 26422.5 | 246 | 4.99 | -0.155 | 47.48 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR008701
Pfam: PF05630
SMART:
KEGG:
PRINTS: