Effector profile
PlantPEAD ID: PlantPEAD03404 Uniprot ID: A0A0G2FPW7 Source: Orthologous
Localization: Apoplastic(Pre) Pathogen taxonomy ID: 1214573 Pathogen type: Fungi
Species: Diaporthe ampelina Strain: DA912 Other name:
Gene name: NCBI Gene ID: LCUC01000139
Entry name: A0A0G2FPW7_9PEZI Protein name: Putative necrosis and ethylene inducing peptide 2
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MSLRTALFSLAVMAGSAFAAPAKLSTRQIIDHNAVASFPESVPDSAVGKLITKYAPHLRIADGCVPFPAVDSMGNIGDGLKPTGSSAGDCSTSQGQVYARAATFRDRFAIMYSWYMPKTEPSAHLGHRHNWNNAIVWLSDDGDEATLLGTSISQKSSYDQSTTPALDGAAPLLYYKSNWPSVHKLYYDSLEGQQESIRVVDVPLVAWDSLPTASQEALATADFGDDEVVPFIDTHFNDKLGAAYGA
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
26422.5 246 4.99 -0.155 47.48
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.