Effector profile
| PlantPEAD ID: PlantPEAD03427 | Uniprot ID: W7ELI7 | Source: Orthologous |
| Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 40125 | Pathogen type: Fungi |
| Species: Bipolaris victoriae | Strain: strain FI3 | Other name: Victoria blight of oats agent,Cochliobolus victoriae |
| Gene name: | NCBI Gene ID: KI968726 | |
| Entry name: W7ELI7_BIPV3 | Protein name: Necrosis-and ethylene-inducing protein 1 | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MLGLRSLSLQLLAAASVVLSSPVNLKSRAVIAHDAVVPFPETVPSGLVGQLMLKYKPFLKVFNGCVPFPAVNAAGDTSGGLNPSGGENSGCSSSTGQVYARATTYNGAYAIMYAWYMPKDSPSGGLGHRHDWENIVVWLSAASTTATIRGVAISAHGNYQKETSPPLEGTRPKIGYRAFWPLNHQLIATNDLGGQQPLIAWDSLTAAARNAIQNTDFGAATPAFRDGTFESALAEAFI
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 25111.4 | 238 | 7.8 | 0.016 | 42.33 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR008701
Pfam: PF05630
SMART:
KEGG:
PRINTS: