Effector profile
PlantPEAD ID: PlantPEAD03654 Uniprot ID: W7E897 Source: Orthologous
Localization: Apoplastic(Pre) Pathogen taxonomy ID: 40125 Pathogen type: Fungi
Species: Bipolaris victoriae Strain: strain FI3 Other name: Victoria blight of oats agent,Cochliobolus victoriae
Gene name: NCBI Gene ID: KI968820
Entry name: W7E897_BIPV3 Protein name: Apple domain-containing protein
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MGANIISRVTPTAPSSSSAGPQQPCPASINCPDNNGCLNSDSTSGRSFTLSCGVDFFGGDLEMQWADGLEACSAACAVNPECVAASFVGNSGSSGPCYLKSKNLGQILDSRVNGKY
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
11789 116 4.52 -0.141 49.41
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.