Effector profile
| PlantPEAD ID: PlantPEAD04160 | Uniprot ID: W7EZM8 | Source: Orthologous |
| Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 40125 | Pathogen type: Fungi |
| Species: Bipolaris victoriae | Strain: strain FI3 | Other name: Victoria blight of oats agent,Cochliobolus victoriae |
| Gene name: | NCBI Gene ID: KI968712 | |
| Entry name: W7EZM8_BIPV3 | Protein name: Carbohydrate-binding module family 50 protein | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MKSTLFAAVAVLAASVSAMPYKQDKDCKSPFPNVSCKPLTLQNYTIVSGDTLTTIADKFGSGACNIVAVNNISDPDKIFPGQKITVPANCTGTVDKTSCLPNALQPTGTQDCVKGLSVNPPVYQVIPKDTFTLIANNFDLKLDALKNANQGRFASFDAIFPGNTTIIPVCQGCSCTNDKYTVVSGDTFSAIAQKAGISIGQIEAANPGQIPEQLQIGQVINRPKCSCNA
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 24083.6 | 229 | 7.96 | 0.001 | 35.01 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR018392,IPR036779
Pfam: PF01476
SMART: SM00257
KEGG:
PRINTS: