Effector profile
| PlantPEAD ID: PlantPEAD05099 | Uniprot ID: W7EFS2 | Source: Orthologous |
| Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 40125 | Pathogen type: Fungi |
| Species: Bipolaris victoriae | Strain: strain FI3 | Other name: Victoria blight of oats agent,Cochliobolus victoriae |
| Gene name: | NCBI Gene ID: KI968733 | |
| Entry name: W7EFS2_BIPV3 | Protein name: Endo-beta-1,4-glucanase D | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MKAGALLALLAAPMAANAHYIFNILVVNGQTIGGEYAYARKNSNAYNPVITNDIVNSNDLRCNRGAVAGNTGTYTVKAGDKIGFKIFNNERIEHPGPGFVYISKAPGKVKDYDGSGVWTKVMESGLANPSAPGVDKSWANWDKDRLEWTIQKSIPAGEYLVRVEHIGLHEGHVGKAQFYMECFQLNIQSSGTGTLGPTVKIPGLYSANDAGIKFNKWNNPKSYSMPGPKLYAGQ
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 25327.7 | 234 | 9.16 | -0.329 | 24.06 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR005103
Pfam: PF03443
SMART:
KEGG:
PRINTS: