Effector profile
| PlantPEAD ID: PlantPEAD06429 | Uniprot ID: W7EC97 | Source: Orthologous |
| Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 40125 | Pathogen type: Fungi |
| Species: Bipolaris victoriae | Strain: strain FI3 | Other name: Victoria blight of oats agent,Cochliobolus victoriae |
| Gene name: | NCBI Gene ID: KI968747 | |
| Entry name: W7EC97_BIPV3 | Protein name: Pectate lyase | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MKASIAASILGFALAASAGPARIYPRNFYTMMKRGSLPVPQGNGTETFSEPKEITGVFDGGLKTYGRGVSCTGQAEGGNSDAVFLLKDGATLKNAIIGKDQIEGVHCEGSCTIENVWWVSVCEDALTLKGDGDATVIGGGATAAQDKVIQHNGKGTVTIENFTVDNFGKLYRACGNCKESAERHVVIKGVKATNGKLLAGINSNFGDSATIDAATCATGVKEICEEFKGTTPGNEPNSVSKGPSSACKFSGSVAAC
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 26357.7 | 256 | 6.32 | -0.127 | 28.7 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR004898,IPR012334,IPR011050
Pfam: PF03211
SMART:
KEGG:
PRINTS: