Effector profile
| PlantPEAD ID: PlantPEAD07220 | Uniprot ID: A0A8H5ZDW8 | Source: Orthologous |
| Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 45130 | Pathogen type: Fungi |
| Species: Bipolaris sorokiniana | Strain: | Other name: Cochliobolus sativus,Common root rot and spot blotch fungus |
| Gene name: | NCBI Gene ID: WNKQ01000016 | |
| Entry name: A0A8H5ZDW8_COCSA | Protein name: LysM domain-containing protein | |
| DOI: | ||
Gene/Protein information
Gene sequence:
ATGAAACCGTCTATGGGAAAAGACTGTACTGGTCTGAACCTGGGCACCATGTATTGCCTCTCCACACTGAAGATTGGCATATTCGCTCCATCCGAGAATGACGTCTCTCCAAGTCCGACTTCGACGAAAGCACCGTTCGGTAGCGGCACGCCGACGCCAATCCAAAATGGCATAGCCGCTGGCTGCACCAAATTCTACAAGGTGATTTCAGGAGACGGCTGCTGGGCCATCTCCAACGCAAACTCGATTGCACTGACGGATTTCTACGCCTGGAATCCCGCAGTAGGATCCGACTGCCAAAACTTGTAG
Protein sequence:
MKPSMGKDCTGLNLGTMYCLSTLKIGIFAPSENDVSPSPTSTKAPFGSGTPTPIQNGIAAGCTKFYKVISGDGCWAISNANSIALTDFYAWNPAVGSDCQNL
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 10587 | 102 | 5.97 | -0.014 | 42.7 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR018392,IPR036779
Pfam: PF01476
SMART:
KEGG:
PRINTS: