Effector profile
| PlantPEAD ID: PlantPEAD08341 | Uniprot ID: Q2HQD9 | Source: Orthologous |
| Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 278946 | Pathogen type: Fungi |
| Species: Botryotinia ranunculi | Strain: CBS178.63 | Other name: |
| Gene name: Nep1 | NCBI Gene ID: AM087054 | |
| Entry name: Q2HQD9_9HELO | Protein name: Putative necrosis and ethylene inducing peptide 1 | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
APIEENTIQARAVVNHDSINPWGENVPGNALGNTLKKFEPFLHIAHGCQPYSAVDGNGNTSGGLQDTGNVSAGCRDQSKGQTYVRGGWSGGRYGIMYAWYFPKDQPAAGNVVGGHRHDWEHIVVWVNNPNVGNPTLIGAAASGHGSVKKTTNPQRQGDRLKVEYYVSFPTNHELQFTNTLGRDLPMMWYDFLPAVSKTALQNTSFGKANCP
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 22938.5 | 211 | 7.95 | -0.562 | 27.21 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR008701
Pfam: PF05630
SMART:
KEGG:
PRINTS: