Effector profile
PlantPEAD ID: PlantPEAD08377 Uniprot ID: A0A3T0ICC0 Source: Orthologous
Localization: Apoplastic(Pre) Pathogen taxonomy ID: 2499830 Pathogen type: Fungi
Species: Botrytis medusae Strain: Other name:
Gene name: Nep1 NCBI Gene ID: MK211250
Entry name: A0A3T0ICC0_9HELO Protein name: Necrosis- and ethylene-inducing protein 1
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MHFSNAKFLSILAAAAAVKGAPIEENTIQARAVVPHDSINPWGENVPGNALGNTLKRFEPFLHIAHGCQPYSAVDGNGNTSGGLQDTGNVSAGCRDQSKGQTYVRGGWSGGRYGIMYAWYFPKDQPAAGNVVGGHRHDWEHVVVWVNNPEVANPTLIGAAASGHGSLKKTTNPQRQGDRLKVEYFVSFPTNHELQFTNTLGRDLPMMWYEFLPEVSKKALEPEIFGKAICPFNNANFNKNLAKAAI
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
26760.1 246 8.39 -0.382 29.48
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.