Effector profile
PlantPEAD ID: PlantPEAD10190 Uniprot ID: A0A4V6J8A0 Source: Orthologous
Localization: Cytoplasmic(Pre) Pathogen taxonomy ID: 5518 Pathogen type: Fungi
Species: Fusarium graminearum Strain: Other name: Gibberella zeae, Wheat head blight fungus
Gene name: NCBI Gene ID: NONE
Entry name: A0A4V6J8A0_GIBZA Protein name: Prion-inhibition and propagation HeLo domain-containing protein
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MAEVFGAVAGAIGIAALFNNCIDCFDYIQISRHFGEDFSKYQLRLDVAKCRLSRWGAAINVNSDPRFSNNASNDQTTTLAETLLGEIVARFESAQKSSLLYKTVSRDQEMQVCSEADLGAVPQRLHSHLRTLTMHRQNRVGLTKKAYWAIYDKNKMGRMIDDIFDLINDLEKVFPATPQATSRLAEMEIQEVNDQQGLMMIQDTAQDLDPILADTTKRKLQEITGQNTSRCISGKGRTNIGHTFVNDSFVQSKGFCDSTFNHVDEINLDETARVNIGNTYGGKGFWDS
Protein structure:
NONE
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
32251.3 288 5.56 -0.398 35.99
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.