Effector profile
| PlantPEAD ID: PlantPEAD10198 | Uniprot ID: N1PJ00 | Source: Orthologous |
| Localization: Cytoplasmic(Pre) | Pathogen taxonomy ID: 64363 | Pathogen type: Fungi |
| Species: Dothistroma septosporum | Strain: strain NZE10 / CBS 128990 | Other name: Red band needle blight fungus,Mycosphaerella pini |
| Gene name: | NCBI Gene ID: KB446542 | |
| Entry name: N1PJ00_DOTSN | Protein name: Prion-inhibition and propagation HeLo domain-containing protein | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MEPAGLAMGVVGVAALFDGCMSAFNYVESGKSFGKDYQKATLKIEILQLRLSRWGESVTRVDEPSQLPAGVALASEQEHRTVEKLLGEILNELEDAERISSRYEPEPAANGYDSGCESIESLTVRTRELALTRQKKVSFGLKAKWALHHKGKLKNLIDSLDGNVKSLVELFPGAKQKQQQLARQEATALAELAQDKEAVLALKEASQELDPDLDSALYTATSGHSFGTVFTSDTASIFAGNYVAHGYTGPISNAQHRFENVQTSDQAKAFFGNQYGGKHIFDD
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 30858.6 | 283 | 5.36 | -0.384 | 38.14 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR029498,IPR038305
Pfam: PF14479
SMART:
KEGG:
PRINTS: