Effector profile
| PlantPEAD ID: PlantPEAD10491 | Uniprot ID: G2XS80 | Source: Orthologous |
| Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 40559 | Pathogen type: Fungi |
| Species: Botrytis cinerea | Strain: strain T4 | Other name: Botryotinia fuckeliana |
| Gene name: | NCBI Gene ID: FQ790260 | |
| Entry name: G2XS80_BOTF4 | Protein name: Protein related to plant expansins | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MQFPTLATLLTFAVSATAITVSYDVGYDDASRSLAVVSCSDGSNGLLTKGYTTQGSLKNFPNIGGASVVAGWNDANCGSCYELSYGGRSINVLVIDHAGAGFNIGEQALNTLTGGQAAALGRIDASYAQVDKSACGL
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 13910.5 | 137 | 4.52 | 0.202 | 32.7 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR010829,IPR036908
Pfam: PF07249
SMART:
KEGG:
PRINTS: