Effector profile
PlantPEAD ID: PlantPEAD10491 Uniprot ID: G2XS80 Source: Orthologous
Localization: Apoplastic(Pre) Pathogen taxonomy ID: 40559 Pathogen type: Fungi
Species: Botrytis cinerea Strain: strain T4 Other name: Botryotinia fuckeliana
Gene name: NCBI Gene ID: FQ790260
Entry name: G2XS80_BOTF4 Protein name: Protein related to plant expansins
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MQFPTLATLLTFAVSATAITVSYDVGYDDASRSLAVVSCSDGSNGLLTKGYTTQGSLKNFPNIGGASVVAGWNDANCGSCYELSYGGRSINVLVIDHAGAGFNIGEQALNTLTGGQAAALGRIDASYAQVDKSACGL
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
13910.5 137 4.52 0.202 32.7
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.