Effector profile
PlantPEAD ID: PlantPEAD10646 Uniprot ID: A0A8H5ZAH7 Source: Orthologous
Localization: Cytoplasmic(Pre) Pathogen taxonomy ID: 45130 Pathogen type: Fungi
Species: Bipolaris sorokiniana Strain: Other name: Cochliobolus sativus，Common root rot and spot blotch fungus
Gene name: NCBI Gene ID: WNKQ01000023
Entry name: A0A8H5ZAH7_COCSA Protein name: Nudix hydrolase domain-containing protein
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MAATQQLSMQSRTGRLNQRYGSQGERLVAGVVPLSADKYYVLLIQSTKRNGWVLPKGGWETDEATAQDAAKREAWEEAGIICKINYDLGLIPEKRRPDQLTSQAPKASYHFFEATVEKQEAQWPEQHKRNRNWFSYSQARQALAERPELLDALDRCTMHRT
Protein structure:
NONE
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
18480.8 161 8.9 -0.822 56.06
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.