Effector profile
| PlantPEAD ID: PlantPEAD10646 | Uniprot ID: A0A8H5ZAH7 | Source: Orthologous |
| Localization: Cytoplasmic(Pre) | Pathogen taxonomy ID: 45130 | Pathogen type: Fungi |
| Species: Bipolaris sorokiniana | Strain: | Other name: Cochliobolus sativus,Common root rot and spot blotch fungus |
| Gene name: | NCBI Gene ID: WNKQ01000023 | |
| Entry name: A0A8H5ZAH7_COCSA | Protein name: Nudix hydrolase domain-containing protein | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MAATQQLSMQSRTGRLNQRYGSQGERLVAGVVPLSADKYYVLLIQSTKRNGWVLPKGGWETDEATAQDAAKREAWEEAGIICKINYDLGLIPEKRRPDQLTSQAPKASYHFFEATVEKQEAQWPEQHKRNRNWFSYSQARQALAERPELLDALDRCTMHRT
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 18480.8 | 161 | 8.9 | -0.822 | 56.06 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR047198,IPR015797,IPR000086
Pfam: PF00293
SMART:
KEGG:
PRINTS: