Effector profile
PlantPEAD ID: PlantPEAD13449 Uniprot ID: M2T6M1 Source: Orthologous
Localization: Apoplastic(Pre) Pathogen taxonomy ID: 45130 Pathogen type: Fungi
Species: Bipolaris sorokiniana Strain: strain ND90Pr / ATCC 201652 Other name: Cochliobolus sativus,Common root rot and spot blotch fungus
Gene name: NCBI Gene ID: KB445642
Entry name: M2T6M1_COCSN Protein name: Tyrosinase copper-binding domain-containing protein
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MLFNSIVLFAAASLTHAVVLPAPQVSDRSKCIDSPQRIEWRKLEPAKQKSHIDAVLCLKTKPSRISLKSLFDDFPHVHFQVASSIHNQATFLPWHRYFTKCYFDALGECGYSGPGTQTLDHDSLIVSPFMSSTTGFDGNGDPNRSEYYAPNGQILSCVDSRPFKDLRPEYLPNSPTEITEGGHCFFRKLAEVNKLEAWNTMKDTLTPEYVANQQKLEVFAKFAPALEANPHGTIHASLGGEMNPTTSPNESLFFLHHPQIDRLWWTW
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
30111.1 267 6.3 -0.364 50.3
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.