Effector profile
PlantPEAD ID: PlantPEAD14145 Uniprot ID: A0A0W8CH46 Source: Orthologous
Localization: Apoplastic(Pre) Pathogen taxonomy ID: 4790 Pathogen type: Oomycota
Species: Phytophthora nicotianae Strain: Race 0 Other name: Brown rot and root rot of citrus agent, buckeye rot agent, pineapple heart rot agent, pistachio foot rot agent, sesame blight agent
Gene name: NCBI Gene ID: NONE
Entry name: A0A0W8CH46_PHYNI Protein name: Elicitin
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MNFRALFAATVAALVGSTSATTCTTTQQTAAYVALVSILSDTSFNQCSTDSGYSMLTATSLPTTEQYKLMCASTACKTMINKIVTLNPPDCELTVPTSGLVLNVFTYANGFSSTCASL
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
12336.1 118 4.86 0.396 23.53
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.