Effector profile
| PlantPEAD ID: PlantPEAD14153 | Uniprot ID: V9FDN6 | Source: Orthologous |
| Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 4792 | Pathogen type: Oomycota |
| Species: Phytophthora parasitica | Strain: P1569 | Other name: Brown rot and root rot of citrus agent, buckeye rot agent, pineapple heart rot agent, pistachio foot rot agent, sesame blight agent |
| Gene name: | NCBI Gene ID: ANIZ01001258 | |
| Entry name: V9FDN6_PHYPR | Protein name: Elicitin | |
| DOI: | ||
Gene/Protein information
Gene sequence:
ATGAACGCCAAGACCATCTTCGCTGTTGCCGCCGCCGCCTTTGTGGGCTCCGCCGCTGCCGATACCTGCTCGTCAACGCAGCAGACGTCCGCGTACACGACGCTGGCGAGCCTACTGACTCTGGACTCGTTCCAGGGCTGTGTTGACGACTCGGGCTACAGCCTCCTGTACTCGACCTCGCTGCCCACGGAC
Protein sequence:
MNAKTIFAVAAAAFVGSAAADTCSSTQQTSAYTTLASLLTLDSFQGCVDDSGYSLLYSTSLPTD
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 6522.2 | 64 | 3.66 | 0.35 | 12.53 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR002200,IPR036470
Pfam: PF00964
SMART:
KEGG:
PRINTS: PR00948