Effector profile
PlantPEAD ID: PlantPEAD14155 Uniprot ID: V9FMD3 Source: Orthologous
Localization: Apoplastic(Pre) Pathogen taxonomy ID: 4792 Pathogen type: Oomycota
Species: Phytophthora parasitica Strain: P1569 Other name: Brown rot and root rot of citrus agent, buckeye rot agent, pineapple heart rot agent, pistachio foot rot agent, sesame blight agent
Gene name: NCBI Gene ID: ANIZ01000875
Entry name: V9FMD3_PHYPR Protein name: Elicitin
DOI:
Gene/Protein information
Gene sequence:
ATGAACACGAAGACTGTCCTCGCCATTGCCGCCGCCGCTTTTGTCGGCTCTGCCGCTGCTGAGACGTGTTCGTCGACGGACCAGACGACCGCGTACTCGACGCTCGCTAGCGTGTTGACCCTGAGCTCGTTCCAGGGTTGCGCCGACGACTCTGGCTTCAGCCTGCTGTACTCGACGTCGCTGCCGGACGACGACCAGTACGTGAAGATGTGCGCTTCGGACAACTGCAAGTCGCTGATCGAGTCG
Protein sequence:
MNTKTVLAIAAAAFVGSAAAETCSSTDQTTAYSTLASVLTLSSFQGCADDSGFSLLYSTSLPDDDQYVKMCASDNCKSLIES
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
8463.37 82 3.89 0.184 25.31
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.