Effector profile
| PlantPEAD ID: PlantPEAD15744 | Uniprot ID: A0A0W8DDQ0 | Source: Orthologous |
| Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 4790 | Pathogen type: Oomycota |
| Species: Phytophthora nicotianae | Strain: race 1 | Other name: Brown rot and root rot of citrus agent, buckeye rot agent, pineapple heart rot agent, pistachio foot rot agent, sesame blight agent |
| Gene name: | NCBI Gene ID: NONE | |
| Entry name: A0A0W8DDQ0_PHYNI | Protein name: ATP-binding Cassette (ABC) superfamily | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MNLRAFIVSIVAALAATDVIALSHDQVRPFGQPSPVSVSEKAAVKFKPQLHITNGCHPYPAVNAAGETSGGLAKSGAPSAGCKGSGWGSQVYGRSTWHKGRWAIMYSWYFPKDSPSTGLGHRHDWEHVIVWIDNPDVANPKILAVTPSAHSGYSKYAPPKAGTVSGNTAKINYESHWPVNHALDSTDKGGETQPLIMWDQMTDAARRSLNTVSFGDANVPMNDGNFLRKIGNASPW
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 25389.5 | 236 | 9.04 | -0.362 | 38.14 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR008701
Pfam: PF05630
SMART:
KEGG:
PRINTS: