Effector profile
| PlantPEAD ID: PlantPEAD15966 | Uniprot ID: A0A2J8BRQ9 | Source: Orthologous |
| Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 27337 | Pathogen type: Fungi |
| Species: Verticillium dahliae | Strain: 12008 | Other name: Verticillium wilt |
| Gene name: | NCBI Gene ID: MPSH01000045 | |
| Entry name: A0A2J8BRQ9_VERDA | Protein name: Necrosis and ethylene inducing peptide | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MLPSAVFSVFALVGIALAQQPPKVNHDSINPVRDTLGPNGDMIRKFQPLLHIAHGCQPYSAVNTRGEVNAGLQDSGTTAGGCKETSKGQTYARSMTLNGQFGIMYAWYWPKDQPADGNLASGHRHDWENVVIWFNSNNANQAGILRGAASGHGDYKKVNNPQRNNNNLHVEYFTSLGKNHELQFKTSPGRTYWIWDWDRMDTTVQGALNRADFGSANCPFNNNNFERNMRAAF
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 25901.8 | 233 | 8.78 | -0.626 | 23.46 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR008701
Pfam: PF05630
SMART:
KEGG:
PRINTS: