Effector profile
PlantPEAD ID: PlantPEAD16039 Uniprot ID: W2Q1I5 Source: Orthologous
Localization: Apoplastic(Pre) Pathogen taxonomy ID: 4792 Pathogen type: Oomycota
Species: Phytophthora parasitica Strain: INRA-310 Other name: Brown rot and root rot of citrus agent, buckeye rot agent, pineapple heart rot agent, pistachio foot rot agent, sesame blight agent
Gene name: NCBI Gene ID: KI669593
Entry name: W2Q1I5_PHYPN Protein name: Apple domain-containing protein
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MHFNFSETQQRNPLHPFHCYWIQTAKWSSRLKFTMMVNTRSRRSSQSPTSCFASDASDQVPPYSTLEFLKTMIARITVAFAGLVAVVSGACSTPSFGNCGSDAAGVSCCQSTQYCQPWNANYYQCLDLPAKCAQQFPNVDFNGDDIQTIYGIQPGECCTRCSETAGCKAYTFVNSNPGQPACYLKSGTGTRTPSVGAVSGILTGTSTTPTPTPTMTPTPTPTTSSPTCTTAPYGSCGSSNGATCCPSGYYCQPWNDSFYQCIQPPAKCSKQLTDKDYYGNDIKTVYVSLPSLCCDACASTAGCKAYTYINNNPGQPVCYLKSAAGTATTKIGAVSGTLN
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
36134.6 339 8.2 -0.276 43.36
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.