Effector profile
PlantPEAD ID: PlantPEAD16158 | Uniprot ID: W2RAA9 | Source: Orthologous |
Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 4792 | Pathogen type: Oomycota |
Species: Phytophthora parasitica | Strain: INRA-310 | Other name: Brown rot and root rot of citrus agent, buckeye rot agent, pineapple heart rot agent, pistachio foot rot agent, sesame blight agent |
Gene name: | NCBI Gene ID: KI669563 | |
Entry name: W2RAA9_PHYPN | Protein name: Phytotoxin PcF domain-containing protein | |
DOI: |
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MNFKTWFAFVFAAVVATVATAEESSLSGDPQYCQGDGCPPLYCEANIQISQACRNDIAVKGGTFEACCKTKCGASA
Loading ...
Main properties of effector
Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
---|---|---|---|---|
7994.06 | 76 | 4.72 | 0.129 | 39.93 |
Plant infestation information
Experimental plant: | |
Susceptible plant: | Disease name: |
Host classification: | NCBI Species: |
Pathogen-plant protein interaction
Uniprot ID | Protein name | Gene name | Species | Protein sequence |
---|
No Record found.
External Links
Interpro: IPR018570
Pfam: PF09461
SMART:
KEGG:
PRINTS: