Effector profile
| PlantPEAD ID: PlantPEAD17242 | Uniprot ID: A0A0W8CHE6 | Source: Orthologous |
| Localization: Cytoplasmic(Pre) | Pathogen taxonomy ID: 4790 | Pathogen type: Oomycota |
| Species: Phytophthora nicotianae | Strain: race 0 | Other name: Brown rot and root rot of citrus agent, buckeye rot agent, pineapple heart rot agent, pistachio foot rot agent, sesame blight agent |
| Gene name: | NCBI Gene ID: LNFO01003197 | |
| Entry name: A0A0W8CHE6_PHYNI | Protein name: glucan endo-1,3-beta-D-glucosidase | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MKLFLPTLVASVVLMLNGGADALNVKMPGVNYNSRKGPDWAPDSSKCKTASEVQKDMYALKGIADKVRIYSLVDCNQAELVLPAAKNAGLKVHLGIWTTKSHDYLLQEKAKLAGLIDSGLYDDNVIGLHVGSETIYREEINADTAISYMKEIRDYIRSRGKNTPVSIADVIDIYNANQQLIDAVDYVSVNQFSFWERSDVNEGAAXTLDRLKNLRVAAANKGKKVVISETGWSSGGSDPAAGVASPENQAKFFSDFFQMARSHDFDYYWYVAFDSKWRVTNGGKEVEADFGIFQEDDTMKSNFQQLTIGWKDPKAIRNAGTNLLLSEKDGNVYMSSKSNDWLVQEQQVWFFDSATKQVRSKSSDRCLDAYQAWDGGIVHVFRCMDNEANQKWTIESETGKLKHATHQGFCLDTDPAQGNKLQLYGCSPNNPNQKWSVIDPATI
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 49384.7 | 443 | 5.62 | -0.437 | 31.92 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR000490,IPR017853,IPR035992,IPR000772
Pfam: PF00332,PF00652
SMART: SM00458
KEGG:
PRINTS: