Effector profile
PlantPEAD ID: PlantPEAD18120 Uniprot ID: A0A0I9YNU2 Source: Orthologous
Localization: Cytoplasmic(Pre) Pathogen taxonomy ID: 5127 Pathogen type: Fungi
Species: Gibberella fujikuroi Strain: Other name: Bakanae and foot rot disease fungus,Fusarium fujikuroi
Gene name: NCBI Gene ID: NONE
Entry name: A0A0I9YNU2_GIBFU Protein name: Secreted protein
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MHISKLFIVGAIVTAAEAFTCARELFGQCYFVDGNPVGQQQRCAIKCENKFGHVNCVCPDYYPKNNKGWPYSGKHECIPVGAYNGRHKCY
Protein structure:
NONE
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
10092.6 90 8.65 -0.277 31.79
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.