Effector profile
PlantPEAD ID: PlantPEAD18121 Uniprot ID: A0A2H3S617 Source: Orthologous
Localization: Cytoplasmic(Pre) Pathogen taxonomy ID: 5127 Pathogen type: Fungi
Species: Gibberella fujikuroi Strain: C2S Other name: Bakanae and foot rot disease fungus,Fusarium fujikuroi
Gene name: NCBI Gene ID: CABFJX010000383
Entry name: A0A2H3S617_GIBFU Protein name: Secreted protein
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MHISKLFIVGAIVTAAEAFTCARELFGQCYFVDGNPVGQQQRCAIKCENKFGHVNCVCPDYYPKNDKGWPYSGKHECIPVGAYNGRHKCY
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
10093.6 90 8.43 -0.277 28.21
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.