Effector profile
| PlantPEAD ID: PlantPEAD19316 | Uniprot ID: A0A081AJS6 | Source: Orthologous |
| Localization: Cytoplasmic(Pre) | Pathogen taxonomy ID: 4792 | Pathogen type: Oomycota |
| Species: Phytophthora parasitica | Strain: P1976 | Other name: Brown rot and root rot of citrus agent, buckeye rot agent, pineapple heart rot agent, pistachio foot rot agent, sesame blight agent |
| Gene name: | NCBI Gene ID: ANJA01001142 | |
| Entry name: A0A081AJS6_PHYPR | Protein name: RxLR effector protein | |
| DOI: | ||
Gene/Protein information
Gene sequence:
TTATCGCGGTAATTCGCATCCTTCCCCCATTTTAGACAGCTTCAGTCCATAGAACAAATTTTCCCCGCCAAGCCTCTCTTCATTATCGTGCTCGGTCATTTTGCCTTCGTCACCCGTCGTCTGGTGGCTTCGAAGGAATCTCTTGTCCTCGCCAGAGATAATACGCGAGGAGTGAACAACGTCCACGTTCGCCACACTGGTCTGATCGGCCTTTGACACTGTCGTGCCACTTGCAAGGAAGGCGCCCGCAAGAACCACAAAGGTCGTGTTGAAGAGACGCAT
Protein sequence:
MRLFNTTFVVLAGAFLASGTTVSKADQTSVANVDVVHSSRIISGEDKRFLRSHQTTGDEGKMTEHDNEERLGGENLFYGLKLSKMGEGCELPR
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 10191.4 | 93 | 5.87 | -0.405 | 31.3 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR031825
Pfam: PF16810
SMART:
KEGG:
PRINTS: