Effector profile
PlantPEAD ID: PlantPEAD19480 Uniprot ID: A0A366PBZ4 Source: Orthologous
Localization: Cytoplasmic(Pre) Pathogen taxonomy ID: 405761 Pathogen type: Fungi
Species: Gibberella moniliformis Strain: Other name: Maize ear and stalk rot fungus,Fusarium verticillioides
Gene name: NCBI Gene ID: NONE
Entry name: A0A366PBZ4_GIBMO Protein name: GP-PDE domain-containing protein
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MNYSEYFADPLRQCAIVAHRGLWNEAPENSLLSVRRAIEAGYDIVEIDVRRTADGEFVLLHDITLDRMTGVDRKPEDLTLGKLISLPLRNRDGGPNNPFTEEKLPSLRDVFDLTRDKIYIHLDIKHRHVIPEVLAYARKMGVDKQVDFWADLKTEGDLAWIKANITIHGVPFIARTHLEHDDWQQQVKLALELKPLICEASFRDISQVDAIQQHFHEAGINLWVNTLDSVASSGFTDSAALDNPEAVWGRLLRAGFSAIQTDEMAALRSFLGTLK
Protein structure:
NONE
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
31148.4 275 5.37 -0.24 34.36
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.