Effector profile
| PlantPEAD ID: PlantPEAD19515 | Uniprot ID: W7M1D3 | Source: Orthologous |
| Localization: Cytoplasmic(Pre) | Pathogen taxonomy ID: 405761 | Pathogen type: Fungi |
| Species: Gibberella moniliformis | Strain: strain M3125 / FGSC 7600 | Other name: Maize ear and stalk rot fungus,Fusarium verticillioides |
| Gene name: | NCBI Gene ID: DS022245 | |
| Entry name: W7M1D3_GIBM7 | Protein name: GP-PDE domain-containing protein | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MNYSEYFADPLRQCAIVAHRGLWNEAPENSLLSVRRAIEAGYDIVEIDVRRTADGEFVLLHDITLDRMTGVDRKPEDLTLGELISLPLRNRDGGPNNPFTEEKLPSLRDVFDLTRDKIYIHLDIKHRHVIPEVLAYARKMGVDKQVDFWADLKTEGDLAWIKANITIHGVPFIARTHLEHDDWQQQVKLALELKPLICEASFRDISQVDAIQQHFHEAGINLWVNTLDSVASSGFTDSAALDNPEAVWGRLLRAGFSAIQTDEMAALRSFLGTLK
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 31149.4 | 275 | 5.2 | -0.238 | 34.7 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR032160,IPR030395,IPR017946
Pfam: PF16387,PF03009
SMART:
KEGG: fvr:FVEG_03450
PRINTS: