Effector profile
PlantPEAD ID: PlantPEAD19515 Uniprot ID: W7M1D3 Source: Orthologous
Localization: Cytoplasmic(Pre) Pathogen taxonomy ID: 405761 Pathogen type: Fungi
Species: Gibberella moniliformis Strain: strain M3125 / FGSC 7600 Other name: Maize ear and stalk rot fungus,Fusarium verticillioides
Gene name: NCBI Gene ID: DS022245
Entry name: W7M1D3_GIBM7 Protein name: GP-PDE domain-containing protein
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MNYSEYFADPLRQCAIVAHRGLWNEAPENSLLSVRRAIEAGYDIVEIDVRRTADGEFVLLHDITLDRMTGVDRKPEDLTLGELISLPLRNRDGGPNNPFTEEKLPSLRDVFDLTRDKIYIHLDIKHRHVIPEVLAYARKMGVDKQVDFWADLKTEGDLAWIKANITIHGVPFIARTHLEHDDWQQQVKLALELKPLICEASFRDISQVDAIQQHFHEAGINLWVNTLDSVASSGFTDSAALDNPEAVWGRLLRAGFSAIQTDEMAALRSFLGTLK
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
31149.4 275 5.2 -0.238 34.7
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.