Effector profile
PlantPEAD ID: PlantPEAD20574 Uniprot ID: C9SDT3 Source: Orthologous
Localization: Apoplastic(Pre) Pathogen taxonomy ID: 1051613 Pathogen type: Fungi
Species: Verticillium alfalfae Strain: strain VaMs.102 / ATCC MYA-4576 / FGSC 10136 Other name: Verticillium wilt of alfalfa,Verticillium albo-atrum
Gene name: NCBI Gene ID: DS985216
Entry name: C9SDT3_VERA1 Protein name: Endoglucanase-1
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MPPIKHLIALATQYAYWSKDGYELINNTWGQDAATSGNQTTYYDGVPSCGKGIAWSSDWEWQGGENNVKSFVYGARQFERRLVSDIHTLPTESQWHYDREDIRANVAYDIFTDTDKDHVNSSGEYELMIWLGRFGGVMPLTEAKRPIAHVNIAGYDWEVYFGYNHGGAMKVYSFLPAQGNIYDFRADVKLFFSYLTKEHQFPADKQYMLVYQLGTEAFTGGPAKFVVPKFIADVR
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
26866.1 235 5.46 -0.43 37.76
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.