Effector profile
| PlantPEAD ID: PlantPEAD21767 | Uniprot ID: W2RD76 | Source: Orthologous |
| Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 4792 | Pathogen type: Oomycota |
| Species: Phytophthora parasitica | Strain: INRA-310 | Other name: Brown rot and root rot of citrus agent, buckeye rot agent, pineapple heart rot agent, pistachio foot rot agent, sesame blight agent |
| Gene name: | NCBI Gene ID: KI669562 | |
| Entry name: W2RD76_PHYPN | Protein name: Probable pectate lyase F | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MVKTFAPFATSAAILIAAATATAVPDGSWPASTGTVQYSEAYIIKAGEVFDGKMQTFERSDVSCEGQTESGADTADALSIKGGTASSVSTVTNCGARYADDKVIQHNGYGTVKIDGFYGEDISKLYRSCGTCGDRPKKVSVTNSYIVNPTNSIVTVNKNWGDQATLKNIWIKSSKASVKVCQWSQGNANGEPKMLGNGPSPPLCQYSESDVHINEK
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 22869.5 | 216 | 6.12 | -0.336 | 25.6 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR004898,IPR012334,IPR011050
Pfam: PF03211
SMART:
KEGG:
PRINTS: