Effector profile
| PlantPEAD ID: PlantPEAD21918 | Uniprot ID: W2WKM3 | Source: Orthologous |
| Localization: Cytoplasmic(Pre) | Pathogen taxonomy ID: 4792 | Pathogen type: Oomycota |
| Species: Phytophthora parasitica | Strain: CJ01A1 | Other name: Brown rot and root rot of citrus agent, buckeye rot agent, pineapple heart rot agent, pistachio foot rot agent, sesame blight agent |
| Gene name: | NCBI Gene ID: ANIX01002690 | |
| Entry name: W2WKM3_PHYPR | Protein name: Probable pectate lyase F | |
| DOI: | ||
Gene/Protein information
Gene sequence:
GCCACGCTCCAGAACATCAAGATCAAGGGCAAGAAGGTGGACGTGTGCCAGTGGTCGCAGGGCTCCACTTCGGGCGAGCCCAAGAAGCTGGGCGCCGGTCCGTCGGGCTCGCTCTGCAAGTACTCCACCAGCACCATCTCCTACGCCTAA
Protein sequence:
ATLQNIKIKGKKVDVCQWSQGSTSGEPKKLGAGPSGSLCKYSTSTISYA
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 5104.83 | 49 | 9.57 | -0.467 | 22.03 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR004898,IPR012334
Pfam:
SMART:
KEGG:
PRINTS: