Effector profile
| PlantPEAD ID: PlantPEAD22671 | Uniprot ID: A0A0E3TKP5 | Source: Orthologous |
| Localization: Apoplastic(Pre) | Pathogen taxonomy ID: 4790 | Pathogen type: Oomycota |
| Species: Phytophthora nicotianae | Strain: NRCPh-155 | Other name: Brown rot and root rot of citrus agent, buckeye rot agent, pineapple heart rot agent, pistachio foot rot agent, sesame blight agent |
| Gene name: Epic1 | NCBI Gene ID: NONE | |
| Entry name: A0A0E3TKP5_PHYNI | Protein name: Extracellular cystatin-like protease inhibitor | |
| DOI: | ||
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MAALRSCLALLACTALVTISAQMDGAYSKKEVTEEDMELLQKAQGNSSTYKPDVTARICYLHVDSLEEQVVSGTNYKFHVSACNIKSDNELGACSNLNCDSSKYDIVIYSQPWTNTLEVTSITAAN
Loading ...
Main properties of effector
| Molecular weight | Sequence length | Theoretical pI | GRAVY | Instability index |
|---|---|---|---|---|
| 13724.5 | 126 | 4.72 | -0.12 | 47.06 |
Plant infestation information
| Experimental plant: | |
| Susceptible plant: | Disease name: |
| Host classification: | NCBI Species: |
Pathogen-plant protein interaction
| Uniprot ID | Protein name | Gene name | Species | Protein sequence |
|---|
No Record found.
External Links
Interpro: IPR000010,IPR046350,IPR018073
Pfam:
SMART:
KEGG:
PRINTS: