Effector profile
PlantPEAD ID: PlantPEAD22850 Uniprot ID: A0A0J6GI27 Source: Orthologous
Localization: Apoplastic(Pre) Pathogen taxonomy ID: 882211 Pathogen type: Bacteria
Species: Pseudomonas deceptionensis Strain: LMG 25555 Other name:
Gene name: NCBI Gene ID: FNUD01000002
Entry name: A0A0J6GI27_PSEDM Protein name: Inhibitor of cysteine peptidase
DOI:
Gene/Protein information
Gene sequence:
NONE
Protein sequence:
MPLARLLPLLGLSLLTACAHQPAHNITVEEQSDCPKQLHIGQQLIVSLPSNPTTGYRWAIQDSAGGVLRSLGPEVYSSSDNGQLLGSGGQSTWRFEVFAAGTGRLRLTSQQPWEPETEPAQVFDCPITVN
Protein structure:
AlphaFold
download
Loading ...
Main properties of effector
Molecular weight Sequence length Theoretical pI GRAVY Instability index
14022.8 130 5.17 -0.189 71.31
Plant infestation information
Experimental plant:
Susceptible plant: Disease name:
Host classification: NCBI Species:
Pathogen-plant protein interaction
Uniprot ID Protein name Gene name Species Protein sequence
No Record found.